PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002657
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 333aa    MW: 37198.8 Da    PI: 9.1715
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58689856PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-19311PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.81.4e-3942102262
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  Lsa002657  42 PHEALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 102
                67899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2743100IPR003851Zinc finger, Dof-type
PfamPF027018.2E-3444100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52546100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MASGVHVMEK PIQLQQQHHH QQQQQQQQQQ HQLQQQQQQH QPHEALKCPR CDSSNTKFCY  60
YNNYSLSQPR HFCKACKRYW TRGGTLRNVP VGGGCRKNKR VKRPITTTVH AAANTNTNPN  120
HNHNPNPRPN PNLDHNHLQS STTSNSNSNH HLNPLFYGLL PQNPNYPRSD ARVSSVNENL  180
VSGYDLPHQP HMNVQGLGFS SMGQGGSLVA NHGHNSNLTF SNYNSSMYGG GSTTSSTSAP  240
TMASLLASSL NHQQQRFMGF ANYDGGSMVK DLKMEEARNR MEWNNNNFHV HNKHDQIEAA  300
VSSDPNSLLW DTDGGGWQLD PSTNIGSSVP SLI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001295692.11e-71dof zinc finger protein DOF1.4
TrEMBLA0A103XF151e-153A0A103XF15_CYNCS; Zinc finger, Dof-type
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.25e-36Dof family protein